PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676746988
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family Whirly
Protein Properties Length: 269aa    MW: 29687.5 Da    PI: 9.7406
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676746988genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly224.77.5e-70922301139
     Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlp 100
                s+yk+kaal+v++++p+f+aldsg++kl+++G+lll++a+a+++r+ydW+kkq+f+ls+ e+++lv+l+++esceffhdp +++s+eGkvrk+lkvePlp
  676746988  92 SIYKGKAALQVEPRAPEFVALDSGAFKLSKDGFLLLQFAPAAGVRQYDWSKKQVFSLSVSEIGTLVSLGARESCEFFHDPNKGKSDEGKVRKVLKVEPLP 191
                7*************************************************************************************************** PP

     Whirly 101 dGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                dGsG+f+nlsv+n+l++++es+++P+++aefavl+s+++
  676746988 192 DGSGHFFNLSVQNKLLNVDESIYIPITRAEFAVLISAFN 230
                ************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.102.6E-7981253IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.8E-7986269IPR009044ssDNA-binding transcriptional regulator
PfamPF085364.1E-6193227IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0009507Cellular Componentchloroplast
GO:0009508Cellular Componentplastid chromosome
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MSQLLSSPPI SVNSNPFISP RFHSSSSVLV AGGFAVTRRG TAWKPTTTLK LSVKSRQTDY  60
FEKQRFGDSS SSPSYSSQNA EGVPARFYVG HSIYKGKAAL QVEPRAPEFV ALDSGAFKLS  120
KDGFLLLQFA PAAGVRQYDW SKKQVFSLSV SEIGTLVSLG ARESCEFFHD PNKGKSDEGK  180
VRKVLKVEPL PDGSGHFFNL SVQNKLLNVD ESIYIPITRA EFAVLISAFN FVLPYLIGWH  240
AFANSIKPED SNRMNNASPN YGGDYEWNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koo_A1e-115802472169Single-stranded DNA-binding protein WHY1, chl
4koo_B1e-115802472169Single-stranded DNA-binding protein WHY1, chl
4koo_C1e-115802472169Single-stranded DNA-binding protein WHY1, chl
4koo_D1e-115802472169Single-stranded DNA-binding protein WHY1, chl
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3324520.0AF332452.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds.
GenBankAF3701560.0AF370156.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds.
GenBankAY0590970.0AY059097.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172893.11e-166single-stranded DNA-binding protein WHY1
SwissprotQ9M9S31e-168WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLR0GJR81e-165R0GJR8_9BRAS; Uncharacterized protein
STRINGAT1G14410.11e-165(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50232752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-164ssDNA-binding transcriptional regulator